PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009609673.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 343aa    MW: 38140.4 Da    PI: 5.9191
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009609673.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.68e-153178148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ +ar  g+ R++k+c++rw +yl
   XP_009609673.1 31 KGLWSPEEDEKLMHYMLTNGQGCWSDVARNAGLQRCGKSCRLRWINYL 78
                     678*******************************************97 PP

2Myb_DNA-binding51.72e-1684128147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E+el+++++ +lG++ W+ Ia +++ gRt++++k++w++ 
   XP_009609673.1  84 RGAFSPQEEELIIHLHSLLGNR-WSQIAGRLP-GRTDNEIKNFWNST 128
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5862678IPR017930Myb domain
SuperFamilySSF466892.68E-2829125IPR009057Homeodomain-like
SMARTSM007171.4E-103080IPR001005SANT/Myb domain
PfamPF002491.6E-133178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-233285IPR009057Homeodomain-like
CDDcd001677.78E-93478No hitNo description
PROSITE profilePS5129425.87779133IPR017930Myb domain
SMARTSM007177.8E-1683131IPR001005SANT/Myb domain
PfamPF002495.6E-1584128IPR001005SANT/Myb domain
CDDcd001674.96E-1186129No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2686134IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MRKPEFSSSS SGKNGTNSNN NNNNANVKLR KGLWSPEEDE KLMHYMLTNG QGCWSDVARN  60
AGLQRCGKSC RLRWINYLRP DLKRGAFSPQ EEELIIHLHS LLGNRWSQIA GRLPGRTDNE  120
IKNFWNSTLK KRLKNSSSSS TPSPNASDSS SEPCKDLNMG INQGFMSMEK HNLMAMYMDS  180
TSSSSSSMAL NTIIDPLPTL EHSLMNMPSR FGAPSYLTTQ PCMVQGGNVT NGSLFYGNNH  240
GIFGGNLGIE GEIYVPPLES VSIEYQNVEG GNLVERSSQN NNPNNNNMTN LTSHFNSSSN  300
IKVENFGGIG NYWEGDDLKV GEWDLEELMK DVSPFPFLDF QVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-272613322128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754501e-160HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009609673.10.0PREDICTED: transcription factor MYB46-like
TrEMBLM1ABG81e-178M1ABG8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000189951e-178(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.12e-67myb domain protein 83